Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009589156.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family VOZ
Protein Properties Length: 475aa    MW: 52944.7 Da    PI: 6.1405
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009589156.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
             VOZ   1 pppsaflgpkcalwdctrpaqgsewlq...dycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwna 92 
                     pppsaflgpkc+lwdc+rpa gs+w+q   dycs +ha+la neg pgt+pv+rp gi+lkd+llf+alsak+ gk+vgipecegaatakspw+a
                     89***********************976668**************************************************************** PP

             VOZ  93 aelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlel 187
                     +elfdl+++egetirewlffdkprrafesgnrkqrslpdy+grgwhesrkqvm+e+gglkrsyymdpqp++ +ewhlyeyein++d +alyrlel
                     *********************************************************************************************** PP

             VOZ 188 klvdekksakgkvskdsladlqkklgrlta 217
                     ****************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589156.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_009589157.10.0PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLM1D4F40.0M1D4F4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000812410.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein